Categories

Archives

A sample text widget

Etiam pulvinar consectetur dolor sed malesuada. Ut convallis euismod dolor nec pretium. Nunc ut tristique massa.

Nam sodales mi vitae dolor ullamcorper et vulputate enim accumsan. Morbi orci magna, tincidunt vitae molestie nec, molestie at mi. Nulla nulla lorem, suscipit in posuere in, interdum non magna.

Wnt protein

By Xiaomin and Jianzhuang

Introduction: Wnt proteins form a family of highly conserved secreted signaling molecules

that regulate cell-to-cell interactions during embryogenesis. Wnt proteins bind to

receptors of the Frizzled and LRP families on the cell surface. Mutations in Wnt genes or

Wnt pathway components lead to specific developmental defects, while various human

diseases, including cancer, are caused by abnormal Wnt signaling.

Bibliographic reference

The Wnt Homepage [http://www.stanford.edu/~rnusse/wntwindow.html]

Cohen ED, Tian Y, Morrisey EE. Wnt signaling: an essential regulator of cardiovascular

differentiation, morphogenesis and progenitor self-renewal.
Development. 2008 Mar;135(5):789-98.

Species used in the alignment:
CLUSTAL W (1.81) multiple sequence alignment

Q8VEJ3 ——KGQEGESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIF
Q9UBT3 ——KGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIF
Q9UBU2 –MSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQ-RKKGSHGLEIF
2jtk_A GSMPHIKGHEGDPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQ-RKKGSHGLEIF
Q9QYZ8 –MPHIKGHEGDPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQ-RKKGSHGLEIF
O94907 –MYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKH-RRKGSHGLEIF
O54908 —-HTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKH-KRKGSHGLEIF
**:**. ***: ** *:*******:******* :*:**:.. … ::. ***

Q8VEJ3 QRCDCGPGLTCRSQVTSNRQH–SRLRVCQRI
Q9UBT3 QRCDCGPGLLCRSQLTSNRQH–ARLRVCQKI
Q9UBU2 QRCDCAKGLSCKVWKDATYSSK-ARLHVCQKI
2jtk_A QRCDCAKGLSCKVWKDATYSSK-ARLHVCQKI
Q9QYZ8 QRCDCAKGLSCKVWKDATYSSK-ARLHVCQKI
O94907 QRCYCGEGLSCRIQKDHHQASNSSRLHTCQR-
O54908 QRCYCGEGLACRIQKDHHQASNSSRLHTCQR-
*** *. ** *. . :**..**.

image

interpretation of the results

The highly conserved domain are almost in the surface of three-dimension structure, which

are in purple color. The inner part of the protein are variable.

questions you are still working on

We can see large part of yellow color in the image. That means there are still some

insufficient data about the conservation of this protein. We need further research on the

yellow part.2jtk

Comments are closed.