Selected Sequence(s)

  • Human immunodeficiency virus type 1, viral sample FLD1, V3 region.

  •  

     
     



    Human immunodeficiency virus type 1, viral sample FLD1, V3 region.
    Locus  HIVFLD1 360 bp ss-RNA VRL 02-AUG-1993
    Definition  Human immunodeficiency virus type 1, viral sample FLD1, V3 region.
    Accession  M90848
    VERSION M90848.1 GI:326847
    Keywords  .
    Source  Human immunodeficiency virus type 1 (HIV-1), M13 clone 1 of DNA ID
    4430.
    Organism  Human immunodeficiency virus type 1
  •  Viruses
  •  Retroid viruses
  •  Retroviridae
  •  Lentivirus
  •  Primate
  •  lentivirus group
  • Reference
    1 (bases 1 to 360)
    Authors  Ou,C.-Y., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C., Korber,B.T.M., Mullins,J.I., Schochetman,G., Berkelman,R.L., Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., Curran,J.W. and Jaffe,H.W.
    Title  Molecular Epidemiology of HIV Transmission in a Dental Practice
    Journal  Science 256, 1165-1171 (1992)
    Medline 
    92271245
    Comment
        Kindly submitted in computer readable form by the CDC (Centers for
    Disease Control), Atlanta, GA.
    The sequence in this entry is one of 6 clone sequences over the V3
    region obtained by the CDC from a Florida dentist. Please note that
    for this set of sequences, clone numbers from the V3 region do not
    correspond with similar numbers from the V4C3V5 region.
    Features
    
    
    Location/Qualifiers
    Source 
    1..360
  • organism="Human immunodeficiency virus type 1"
  • db_xref="taxon:11676"
  • CDS 
    <1..>360
  • note="env polyprotein"
  • codon_start=1
  • protein_id="AAA44442.1"
  • db_xref="GI:326848"
  • translation="LAEEEVVIRSANFTDNAKIIIVQLNASVEINCTRPNNNTRKGIH IGPGRAFYATGEIIGDIRQAHCNISREKWNNTLNQVVTELREQFGNKTITFNHSSGGD PEIVMHSFNCGGEFFYCN"
  • Base Count Adenine: 148
    Cytosine: 50
    Guanine: 73
    Thymine: 89Nucleic Sequence
    CTAGCAGAAGAAGAGGTAGTAATTAGATCTGCCAATTTCACAGACAATGCTAAAATCATAATAGTACAGC
    TGAATGCATCTGTAGAAATTAATTGTACAAGGCCCAACAACAATACAAGAAAAGGTATACATATAGGACC
    AGGGAGAGCATTTTATGCAACAGGAGAAATAATAGGAGATATAAGACAAGCACATTGTAACATTAGTAGA
    GAAAAATGGAATAATACTTTAAACCAGGTAGTTACAGAATTAAGGGAACAATTTGGGAATAAAACAATAA
    CCTTTAATCACTCCTCAGGAGGGGACCCAGAAATTGTAATGCACAGTTTTAATTGTGGAGGGGAATTTTT
    CTATTGTAAT
    
    
    
    
    Database Citation(s)

    Copyright (C) 1999, Board of Trustees of the University of Illinois.