Sequence alignment

Consensus key (see documentation for details)

* - single, fully conserved residue

: - conservation of strong groups

. - conservation of weak groups

  - no consensus

 

 

CLUSTAL W (1.8) multiple sequence alignment

 

 

GDF5_MOUSE      MRLPKLLTLLLWHLAWLDLELICTVLGAPDLGQRTPGAKPGLTKAEAKERPPLARNVFRP

GDF5_HUMAN      MRLPKLLTFLLWYLAWLDLEFICTVLGAPDLGQRPQGSRPGLAKAEAKERPPLARNVFRP

                ********:***:*******:*************. *::***:*****************

 

GDF5_MOUSE      GGHIYGVGAT--NARAKGSSGQT----QAKKDEPRKMPPRSGGSETKPGPSSQTRQAAAR

GDF5_HUMAN      GGHSYGGGATNANARAKGGTGQTGGLTQPKKDEPKKLPPRPGGPEPKPGHPPQTRQATAR

                *** ** ***  ******.:***    *.*****:*:***.**.*.*** ..*****:**

 

GDF5_MOUSE      TVTPKGQLPGGKASSKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITPHEYMLSLYRTL

GDF5_HUMAN      TVTPKGQLPGGKAPPKAGSVPSSFLLKKAREPGPPREPKEPFRPPPITPHEYMLSLYRTL

                *************..****.********:****.**************************

 

GDF5_MOUSE      SDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPAVRKQRYVFDISALEKDGLLGAELR

GDF5_HUMAN      SDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKDGLLGAELR

                ***********************************.************************

 

GDF5_MOUSE      ILRKKPLDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLF

GDF5_HUMAN      ILRKKPSDTAKPAVPRSRRAAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLF

                ****** *.****** * *.****************************************

 

GDF5_MOUSE      RNFKNSAQLCLELEAWERGRAVDLRGLGFERTARQVHEKALFLVFGRTKKRDLFFNEIKA

GDF5_HUMAN      RNFKNSAQLCLELEAWERGRTVDLRGLGFDRAARQVHEKALFLVFGRTKKRDLFFNEIKA

                ********************:********:*:****************************

 

GDF5_MOUSE      RSGQDDKTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIA

GDF5_HUMAN      RSGQDDKTVYEYLFSQRRKRRAPSATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIA

                *********************** *.**********************************

 

GDF5_MOUSE      PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFID

GDF5_HUMAN      PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFID

                ************************************************************

 

GDF5_MOUSE      SANNVVYKQYEDMVVESCGCR

GDF5_HUMAN      SANNVVYKQYEDMVVESCGCR

                *********************

 

Clustal W options and diagnostic messages

Alignment type: Protein                 Alignment order: aligned               

 

                    Pairwise alignment parameters

 

Method: accurate                       

Matrix: Gonnet                         

Gap open pentalty: 10.00                Gap extension pentalty: 0.10           

 

                    Multiple alignment parameters

 

Matrix: Gonnet                          Negative matrix?: no                   

Gap open pentalty: 10.00                Gap extension pentalty: 0.20           

% identity for delay: 30                Residue-specific gap penalties: on     

Penalize end gaps: on                   Hydrophylic gap penalties: on          

Gap separation distance: 0              Hydrophylic residues: GPSNDQEKR        

 

 

 

 

 CLUSTAL W (1.8) Multiple Sequence Alignments

 

 

 

Sequence type explicitly set to Protein

Sequence format is Pearson

Sequence 1: GDF5_MOUSE      495 aa

Sequence 2: GDF5_HUMAN      501 aa

Start of Pairwise alignments

Aligning...

Sequences (1:2) Aligned. Score:  91

Guide tree        file created:   [cw27117.dnd]

Start of Multiple Alignment

There are 1 groups

Aligning...

Group 1: Sequences:   2      Score:10367

Alignment Score 2900

CLUSTAL-Alignment file created  [cw27117.aln]

Clustal W dendogram

(1_GDF5_MOUSE:0.04242,0_GDF5_HUMAN:0.04242);